Pfam domain
Pfam family: Homeobox (PF00046.28)
Uniprot AC: P14859
RecName: POU domain, class 2, transcription factor 1
Begin-End: 380-436
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
RKKRTSIETNIRVALEKSFLENQKPTSEEITMIADQLNMEKEVIRVWFCNRRQKEKR
Structures of the domain P14859 380-436
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1cqt X-ray 3.2 A 102-158  H-Bb H-Mj L-Bb L-Mn 
1cqt X-ray 3.2 B 602-658  H-Bb H-Mj L-Bb 
1oct X-ray 3 C 102-158  H-Bb H-Mj L-Bb L-Mn 
1hf0 X-ray 2.7 B 102-158  H-Bb H-Mj L-Bb L-Mn 
1hf0 X-ray 2.7 A 102-158  H-Bb H-Mj L-Bb L-Mn 
1gt0 X-ray 2.6 C 102-158  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2019

text