Pfam domain
Pfam family: Sigma70_r2 (PF04542.13)
Uniprot AC: A0A045HD00
RecName: RNA polymerase sigma factor SigA
Begin-End: 295-365
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj H-Mn 

Sequence:
LLEANLRLVVSLAKRYTGRGMAFLDLIQEGNLGLIRAVEKFDYTKGYKFSTYATWWIRQA
ITRAMADQART
Structures of the domain A0A045HD00 295-365
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 F 295-364  H-Bb H-Mj H-Mn 
6c04 X-ray 3.27 F 295-364  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2019

text