Pfam domain
Pfam family: Sigma70_r3 (PF04539.15)
Uniprot AC: A0A045HD00
RecName: RNA polymerase sigma factor SigA
Begin-End: 374-451
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
EVINKLGRIQRELLQDLGREPTPEELAKEMDITPEKVLEIQQYAREPISLDQTIGDEGDS
QLGDFIEDSEAVVAVDAV
Structures of the domain A0A045HD00 374-451
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 F 374-449 None
6c04 X-ray 3.27 F 374-449 None


© NPIDB team 2003 - 2019

text