Pfam domain
Pfam family: Sigma70_r4 (PF04545.15)
Uniprot AC: A0A045HD00
RecName: RNA polymerase sigma factor SigA
Begin-End: 463-516
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
VLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRH
Structures of the domain A0A045HD00 463-516
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 F 463-516  H-Bb H-Mj 
6c04 X-ray 3.27 F 463-516  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2019

text