Pfam domain
Pfam family: RbpA (PF13397.5)
Uniprot AC: A0A045IP01
RecName: RNA polymerase-binding protein RbpA
Begin-End: 4-106
Organism: Mycobacterium tuberculosis
Interaction Mode:  L-Bb 

Sequence:
RVLRGSRLGAVSYETDRNHDLAPRQIARYRTDNGEEFEVPFADDAEIPGTWLCRNGMEGT
LIEGDLPEPKKVKPPRTHWDMLLERRSIEELEELLKERLELIR
Structures of the domain A0A045IP01 4-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 J 4-106  L-Bb 
6c04 X-ray 3.27 J 4-106 None


© NPIDB team 2003 - 2019

text