Pfam domain
Pfam family: RNA_pol_L (PF01193.23)
Uniprot AC: A0A045J8T1
RecName: DNA-directed RNA polymerase subunit alpha
Begin-End: 24-219
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
EPLEPGFGYTLGNSLRRTLLSSIPGAAVTSIRIDGVLHEFTTVPGVKEDVTEIILNLKSL
VVSSEEDEPVTMYLRKQGPGEVTAGDIVPPAGVTVHNPGMHIATLNDKGKLEVELVVERG
RGYVPAVQNRASGAEIGRIPVDSIYSPVLKVTYKVDATRVEQRTDFDKLILDVETKNSIS
PRDALASAGKTLVELF
Structures of the domain A0A045J8T1 24-219
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 B 24-218 None
6bzo X-ray 3.38 A 24-218 None
6c04 X-ray 3.27 B 24-218 None
6c04 X-ray 3.27 A 24-218 None


© NPIDB team 2003 - 2019

text