Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: A0A045J9E2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 4-417
Organism: Mycobacterium tuberculosis
Interaction Mode:  H-Bb H-Mj L-Bb 

Sequence:
VNFFDELRIGLATAEDIRQWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCG
KYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPK
DLEKIIYFAAYVITSVDEEMRHNELSTLEAEMAVERKAVEDQRDGELEARAQKLEADLAE
LEAEGAKADARRKVRDGGEREMRQIRDRAQRELDRLEDIWSTFTKLAPKQLIVDENLYRE
LVDRYGEYFTGAMGAESIQKLIENFDIDAEAESLRDVIRNGKGQKKLRALKRLKVVAAFQ
QSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAP
EIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNL
Structures of the domain A0A045J9E2 4-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 D 7-417  L-Bb 
6c04 X-ray 3.27 D 7-417  H-Bb H-Mj 


© NPIDB team 2003 - 2019

text