Pfam domain
Pfam family: RNA_pol_Rpb1_3 (PF04983.17)
Uniprot AC: A0A045J9E2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 564-736
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
NILSPASGRPLAMPRLDMVTGLYYLTTEVPGDTGEYQPASGDHPETGVYSSPAEAIMAAD
RGVLSVRAKIKVRLTQLRPPVEIEAELFGHSGWQPGDAWMAETTLGRVMFNELLPLGYPF
VNKQMHKKVQAAIINDLAERYPMIVVAQTVDKLKDAGFYWATRSGVTVSMADV
Structures of the domain A0A045J9E2 564-736
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 D 564-736 None
6c04 X-ray 3.27 D 564-736 None


© NPIDB team 2003 - 2019

text