Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.23)
Uniprot AC: A0A0A1E0U0
RecName: DNA ligase
Begin-End: 126-318
Organism: African swine fever virus
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb 

Sequence:
PMLVKYFNIIPKTFFEEETDPIVQRKRNGVRAVACQQGDGCILLYSRTEKEFLGLDNIKK
ELKQLYLFIDVRVYLDGELYLHRKPLQWIAGQANAKTDSSELHFYVFDCFWSDQLQMPSN
KRQQLLTNIFKQKEDLTFIHQVENFSVKNVDEALRLKAQFIKEGYEGAIVRNANGPYEPG
YNNYHSAHLAKLK
Structures of the domain A0A0A1E0U0 126-318
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6imk X-ray 2.5 A 126-318  H-Bb H-Mn S-Bb L-Bb 
6imn X-ray 2.7 B 126-318  H-Bb S-Bb L-Bb 
6imn X-ray 2.7 A 126-318  H-Bb S-Bb L-Bb 
6iml X-ray 2.35 A 126-318  H-Bb S-Bb L-Bb 
6imj X-ray 2.55 A 125-318 None
6imj X-ray 2.55 B 125-318 None


© NPIDB team 2003 - 2021

text