Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.5)
Uniprot AC: A0A0A1E3N6
RecName: DNA polymerase beta-like protein
Begin-End: 112-174
Organism: African swine fever virus
Interaction Mode:   

Sequence:
AIFHFTGPVSYLIRIRAALKKKNYKLNQYGLFKNQTLVPLKITTEKELIKELGFTYRIPK
KRL
Structures of the domain A0A0A1E3N6 112-174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5hri X-ray 2.2 A 112-173 None
5hri X-ray 2.2 B 112-173 None
5hrd X-ray 1.8 B 112-173 None
5hrd X-ray 1.8 A 112-173 None
5hrd X-ray 1.8 C 112-173 None
5hrd X-ray 1.8 D 112-173 None
5hrf X-ray 2.25 B 112-173 None
5hrf X-ray 2.25 A 112-173 None
5hrk X-ray 2.9 A 112-173 None
5hrk X-ray 2.9 B 112-173 None
5hr9 X-ray 2.2 A 112-173 None
5hr9 X-ray 2.2 B 112-173 None
5hrh X-ray 3 A 112-173 None
5hrh X-ray 3 B 112-173 None
5hrb X-ray 1.7 A 112-173 None
5hrg X-ray 2 A 112-173 None
5hrg X-ray 2 B 112-173 None
5hrl X-ray 2.4 A 112-173 None
5hrl X-ray 2.4 B 112-173 None


© NPIDB team 2003 - 2020

text