Pfam domain
Pfam family: DNA_ligase_OB_2 (PF14743.8)
Uniprot AC: A0A0A2ACP7
RecName: ATP-dependent DNA ligase
Begin-End: 356-434
Organism: Prochlorococcus marinus str. MIT 9302
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb L-Mn 

Sequence:
EGTGRNKGRLGAILVEGEDDGYEYSLSCGSGFSDIQREEYWSKRKHLLGQLVEIRADAKT
KSKDGVAFSLRFPRFKCFR
Structures of the domain A0A0A2ACP7 356-434
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6rar X-ray 1.79 I 356-434  H-Bb S-Bb L-Bb L-Mn 
6rau X-ray 1.99 I 356-434  H-Bb S-Bb S-Mn L-Bb L-Mn 
6ras X-ray 2.75 I 356-434  H-Bb S-Bb L-Bb L-Mn 
6rce X-ray 1.95 I 356-434  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text