Pfam domain
Pfam family: Sigma70_ner (PF04546.15)
Uniprot AC: A0A0B3WH85
RecName: RNA polymerase sigma factor RpoD
Begin-End: 127-313
Organism: Francisella tularensis subsp. holarctica
Interaction Mode:   

Sequence:
YPIVIKTYIERFRELEEKAIDYMNSQDIENEPVARYIRFNEVMAGFSDEQVTEEKVAEDD
HEEKIDTQRAYEFFTNLEKMFEEYQDKPNKKLYTKIVKEFDNLRLSTSHLQKLVDYIRLP
YARVKEFERKILRLCVERSKTPRQEFIKVYKVGSLEWLEPLTKKYKFTENTIREIKNLTK
QINQFQI
Structures of the domain A0A0B3WH85 127-313
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wmr X-ray 3.46 Z 133-313 None
6wmt X-ray 4.43 Z 133-313 None


© NPIDB team 2003 - 2021

text