Pfam domain
Pfam family: Ribosomal_S6 (PF01250.16)
Uniprot AC: A0A0D6J3X3
RecName: 30S ribosomal protein S6
Begin-End: 3-92
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PYEIMVILDPTLDERTVAPSLETFLNVIRKDGGTVDKVDIWGRRRLAYEIAKHAEGIYAV
IDVKAEPATVSELDRQLNLNESVLRTKVLR
Structures of the domain A0A0D6J3X3 3-92
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o5j X-ray 3.45 F 4-92 None


© NPIDB team 2003 - 2019

text