Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: A0A0F7UXI8
RecName: 40S ribosomal protein S3, putative
Begin-End: 22-98
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
ELNEFLSCTLSEDGYSGVEVRVTPIRTEIIIRATRTREVLGDKGRRIRELTSVVQKRFGF
APDSVELFAERVENRGL
Structures of the domain A0A0F7UXI8 22-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 D 20-95 None


© NPIDB team 2003 - 2019

text