Pfam domain
Pfam family: TFIIF_alpha (PF05793.14)
Uniprot AC: A0A0H2UKZ8
RecName: Transcription initiation factor iif subunit alpha
Begin-End: 343-412
Organism: Saccharomyces mikatae
Interaction Mode:   

Sequence:
YPWVMEDFDGYNTWVGSYEAGNSDSYVLLSVEDDGSFTMIPADKVYKFTARNKYATLTID
EAEKRMDKKS
Structures of the domain A0A0H2UKZ8 343-412
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v1o X-ray 9.7 Q 133-412 None
4v1n X-ray 7.8 Q 133-412 None


© NPIDB team 2003 - 2021

text