Pfam domain
Pfam family: MarR_2 (PF12802.9)
Uniprot AC: A0A0H2VJZ8
RecName: TcaR transcription regulator
Begin-End: 34-94
Organism: Staphylococcus epidermidis
Interaction Mode:   

Sequence:
YGISAEQSHVLNMLSIEALTVGQITEKQGVNKAAVSRRVKKLLNAELVKLEKPDSNTDQR
L
Structures of the domain A0A0H2VJZ8 34-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4kdp X-ray 3.6 G 34-94 None
4kdp X-ray 3.6 F 34-94 None
4kdp X-ray 3.6 E 34-94 None
4kdp X-ray 3.6 D 34-94 None
4kdp X-ray 3.6 C 34-94 None
4kdp X-ray 3.6 B 34-94 None
4kdp X-ray 3.6 A 34-94 None


© NPIDB team 2003 - 2021

text