Pfam domain
Pfam family: eIF-1a (PF01176.18)
Uniprot AC: A0A0J9X202
RecName: Eif1a
Begin-End: 15-77
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
GQEYAQITKMLGNGRVEASCFDGNKRMAHIRGKLRKKVWMGQGDIILVSLRDFQDDQCDV
VHK
Structures of the domain A0A0J9X202 15-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 0 32-94 None


© NPIDB team 2003 - 2019

text