Pfam domain
Pfam family: KH_2 (PF07650.16)
Uniprot AC: A0A0J9X205
RecName: US3
Begin-End: 18-94
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
ELNEFFTRELAEEGYSGVEVRVTPTKTEVIIRATRTQDVLGENGRRINELTLLVQKRFKY
APGTIVLYAERVQDRGL
Structures of the domain A0A0J9X205 18-94
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 C 20-93 None


© NPIDB team 2003 - 2019

text