Pfam domain
Pfam family: SUI1 (PF01253.21)
Uniprot AC: A0A0J9X208
RecName: eIF1
Begin-End: 1-75
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
YIHIRIQQRNGRKTLTTVQGVPEEYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQ
RAKVCEFMISQLGLQ
Structures of the domain A0A0J9X208 1-75
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 F 25-98 None


© NPIDB team 2003 - 2020

text