Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: A0A0J9X211
RecName: US9
Begin-End: 9-141
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
GKKKSATAVAHVKAGKGLIKVNGSPITLVEPEILRFKVYEPLLLVGLDKFSNIDIRVRVT
GGGHVSQVYAIRQAIAKGLVAYHQKYVDEQSKNELKKAFTSYDRTLLIADSRRPEPKKFG
GKGARSRFQKSYR
Structures of the domain A0A0J9X211 9-141
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 I 11-143 None


© NPIDB team 2003 - 2019

text