Pfam domain
Pfam family: Ribosomal_S17e (PF00833.17)
Uniprot AC: A0A0J9X224
RecName: ES17
Begin-End: 1-119
Organism: Lachancea kluyveri
Interaction Mode:   

Sequence:
GRVRTKTVKRASKALIERYYPKLTLDFQTNKRLCDEIATIQSKRLRNKIAGYTTHLMKRI
QKGPVRGISFKLQEEERERKDQYVPEVSRSNGVLNVDNQTSDLVKSLGLKLPLSVINVS
Structures of the domain A0A0J9X224 1-119
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4uer X-ray 6.47 V 2-116 None


© NPIDB team 2003 - 2019

text