Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: A0A0K0GMR0
RecName: Transcription termination/antitermination protein NusA
Begin-End: 127-194
Organism: Xanthomonas oryzae pv. oryzae
Interaction Mode:   

Sequence:
KDRVGELITGVVKRAERGNIFVDLGGNAEAFIPKDKGIPRDVLRPGDRVRGYLAEVRSEP
RGPQLFIS
Structures of the domain A0A0K0GMR0 127-194
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j9e X-ray 3.41 F 135-194 None


© NPIDB team 2003 - 2021

text