Pfam domain
Pfam family: Mrr_cat_2 (PF13156.5)
Uniprot AC: A0A0M3KL05
RecName: LlaBIII
Begin-End: 46-169
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
KNEPTYKALYQNVWLLSEVPESYGIPKKDTGVDLVAEQKNGDLVAIQAKFYTNKVGKSEI
NSFVAELGKSYYQRGLIVSTMDDWNSNARETIDQNEKGIEIIGLSDLRNSQIDWSQFNFE
RPEN
Structures of the domain A0A0M3KL05 46-169
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xqk X-ray 2.7 B 47-164 None
4xqk X-ray 2.7 A 46-167 None


© NPIDB team 2003 - 2019

text