Pfam domain
Pfam family: Helicase_C (PF00271.30)
Uniprot AC: A0A0M3KL05
RecName: LlaBIII
Begin-End: 483-601
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:   

Sequence:
DGAPLERAIAFTRTIEESKKVSSQFEEVVNEYISEAIEDESIHLSMRHADGQMNALQKGE
VLDWLANPNKPADEARIVSNVRFLTEGIDIPTLDAVIFLSPKKSQVDIVQAVGRIMRKA
Structures of the domain A0A0M3KL05 483-601
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xqk X-ray 2.7 B 488-600 None
4xqk X-ray 2.7 A 488-600 None


© NPIDB team 2003 - 2019

text