Pfam domain
Pfam family: N6_Mtase (PF02384.15)
Uniprot AC: A0A0M3KL05
RecName: LlaBIII
Begin-End: 840-1190
Organism: Lactococcus lactis subsp. cremoris
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mn 

Sequence:
DKQKIIVTLYDKFFKTAFKATTERLGIVFTPIEVVDFIVHSVDDVLKKHFGKSLASKDVH
ILDPFTGTGTFIVRTLTYLKEQMDAGEISLADITRKFMKELHANEIVLLSYYIAAINIES
TFDEINGDEEGYVPFEGIVLTDTFESTETEDTLDDDYFGTNDERLKRQQKVPITVIMGNP
PYSAKQKNEDGNQIRTTYEKLDASLQNSWVETSTATNKNNLFDSYIRAMRWSSDRISDNG
VIGFITNNSFIDGNAMDGMRQSLLEEFSDIYVLNLKGGIRGKTKDQSALEGGNIFDIMTG
VTIIMLIKKSDYTVEGRIHYLDIGNNLDKYQKLEKLKNWKSLNGATSEFQN
Structures of the domain A0A0M3KL05 840-1190
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4xqk X-ray 2.7 B 844-1105  H-Bb H-Mn S-Bb L-Bb L-Mn 
4xqk X-ray 2.7 A 844-1105 None


© NPIDB team 2003 - 2020

text