Pfam domain
Pfam family: Ribosomal_S9 (PF00380.18)
Uniprot AC: A0A0M3KL59
RecName: Mitoribosomal protein us9m, mrps9
Begin-End: 275-397
Organism: Sus scrofa
Interaction Mode:   

Sequence:
GKRKTAKAEVVVYGQGSGRIDVNGVDYLLYFPVTQDREQLMFPLHFLDRLGKHDMTCAVS
GGGRSAQAGAVRLAMARALCSFVTEDEVEWMRQAGLLTADPRVRERKKPGQEGARRKFTW
KKR
Structures of the domain A0A0M3KL59 275-397
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aj3 X-ray 3.6 I 275-397 None


© NPIDB team 2003 - 2019

text