Pfam domain
Pfam family: Trans_reg_C (PF00486.27)
Uniprot AC: A0A0R4I965
RecName: DNA-binding transcriptional regulator BasR
Begin-End: 144-216
Organism: Klebsiella pneumoniae JM45
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
GETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSGDNEPATNTLEVHIHNLREKIGK
SRIRTVRGFGYML
Structures of the domain A0A0R4I965 144-216
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s04 X-ray 3.2 A 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4s04 X-ray 3.2 B 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4s04 X-ray 3.2 F 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4s04 X-ray 3.2 E 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 
4s05 X-ray 3.8 B 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj 
4s05 X-ray 3.8 A 147-216  H-Bb H-Mj S-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2020

text