Pfam domain
Pfam family: Response_reg (PF00072.23)
Uniprot AC: A0A0R4I965
RecName: DNA-binding transcriptional regulator BasR
Begin-End: 3-113
Organism: Klebsiella pneumoniae JM45
Interaction Mode:   

Sequence:
ILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHF
LSRMRREKMTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIR
Structures of the domain A0A0R4I965 3-113
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4s04 X-ray 3.2 B 3-113 None
4s04 X-ray 3.2 A 3-113 None
4s04 X-ray 3.2 F 3-113 None
4s04 X-ray 3.2 E 3-113 None
4s05 X-ray 3.8 B 3-113 None
4s05 X-ray 3.8 A 3-113 None


© NPIDB team 2003 - 2019

text