Pfam domain
Pfam family: Ribosomal_L18p (PF00861.21)
Uniprot AC: A0A0R4J8D5
RecName: ICT1
Begin-End: 70-180
Organism: Sus scrofa
Interaction Mode:   

Sequence:
ARKERGWGTVWPSREFWHRLRVIRTQHHIEALVEHRNGQVVVSASTREWAIKKHLYSTRN
VVACESVGRVLAERCLEAGINFMVYHPTPWEAASDSIKRLQHAMTEGGVVL
Structures of the domain A0A0R4J8D5 70-180
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4v19 X-ray 3.4 S 79-147 None


© NPIDB team 2003 - 2020

text