Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.21)
Uniprot AC: A0A0T9N9K3
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 81-144
Organism: Mycobacterium tuberculosis
Interaction Mode:   

Sequence:
ELLDRVSSKYALVIYAAKRARQINDYYNQLGEGILEYVGPLVEPGLQEKPLSIALREIHA
DLLE
Structures of the domain A0A0T9N9K3 81-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6bzo X-ray 3.38 E 42-104 None
6c04 X-ray 3.27 E 42-104 None


© NPIDB team 2003 - 2019

text