Pfam domain
Pfam family: LAGLIDADG_1 (PF00961.18)
Uniprot AC: A0A158RFF2
RecName: Meganuclease I-AabMI
Begin-End: 162-260
Organism: Gremmeniella abietina
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
LSGFASAEGCFMVGIAKSSASSTGYQVYLTFILTQHVRDENLMKCLVDYFNWGRLARKRN
VYEYQVSKFSDVEKLLSFFDKYPILGEKAKDLQDFCSVS
Structures of the domain A0A158RFF2 162-260
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4yit X-ray 3.24 A 162-259  H-Bb S-Bb S-Mj L-Bb L-Mj 
4yit X-ray 3.24 D 162-259  H-Bb S-Bb S-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2020

text