Pfam domain
Pfam family: DNA_ligase_A_M (PF01068.23)
Uniprot AC: A0A1J0SCU0
RecName: DNA ligase
Begin-End: 31-231
Organism: Alteromonas mediterranea
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
LQLAKQYSHSRQDINIAEYWVSEKLDGIRARWDGTELRTRNNNKIAAPAWFTANWPKATI
DGELWIARGQFERTASIVLSKLTSVAPHSVAGSLPRTESTVGAMTATHSLPSKRWAKIRF
MAFDMPVAGQSFDSRLNMLNNLKEATPNPTFAVVSQFTLSSVNALEEKLEQVTLSGGEGL
MLHHKKAFYHSGRSDKLLKVK
Structures of the domain A0A1J0SCU0 31-231
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gdr X-ray 2.33 A 12-211  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text