Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: A0A1L8FQ56
RecName: Histone H2B
Begin-End: 31-102
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
RKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTI
TSREIQTAVRLL
Structures of the domain A0A1L8FQ56 31-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fq5 X-ray 3.8 H 28-97 None
6fq5 X-ray 3.8 D 28-97 None


© NPIDB team 2003 - 2019

text