Pfam domain
Pfam family: Histone (PF00125.23)
Uniprot AC: A0A1L8FQ56
RecName: Histone H2B
Begin-End: 36-102
Organism: Xenopus laevis
Interaction Mode:   

Sequence:
ESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREI
QTAVRLL
Structures of the domain A0A1L8FQ56 36-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6fq8 X-ray 4.8 H 34-97 None
6fq8 X-ray 4.8 D 34-97 None
6fq6 X-ray 4 D 33-97 None
6fq6 X-ray 4 H 34-97 None


© NPIDB team 2003 - 2019

text