Pfam domain
Pfam family: RecA (PF00154.23)
Uniprot AC: A0A376NU07
RecName: Protein RecA
Begin-End: 9-270
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGAGGLPMGRIVEIYGP
ESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPIYARKLGVDIDNLLCSQPDTGEQALE
ICDALARSGAVDVIVVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNT
LLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVV
KNKIAAPFKQAEFQILYGEGIN
Structures of the domain A0A376NU07 9-270
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7jy6 X-ray 2.5 A 8-269 None
7jy6 X-ray 2.5 F 8-269 None
7jy6 X-ray 2.5 G 8-269 None
7jy6 X-ray 2.5 H 8-269 None
7jy6 X-ray 2.5 E 8-269 None
7jy6 X-ray 2.5 D 8-269 None
7jy6 X-ray 2.5 C 8-269 None
7jy6 X-ray 2.5 B 8-269 None
7jy7 X-ray 2.9 A 8-269  H-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 B 8-269  H-Bb H-Mn L-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 C 8-269  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 D 8-269  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 E 8-269  H-Bb S-Bb L-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 F 8-269  S-Bb L-Bb L-Mj L-Mn 
7jy7 X-ray 2.9 G 8-269 None
7jy7 X-ray 2.9 H 8-269 None
7jy8 X-ray 2.5 A 8-269  H-Bb L-Mj L-Mn 
7jy8 X-ray 2.5 B 8-269  H-Bb H-Mn L-Bb L-Mj L-Mn 
7jy8 X-ray 2.5 C 8-269  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
7jy8 X-ray 2.5 D 8-269  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
7jy8 X-ray 2.5 E 8-269  S-Bb S-Mj L-Mj L-Mn 
7jy8 X-ray 2.5 F 8-269 None
7jy8 X-ray 2.5 G 8-269 None
7jy8 X-ray 2.5 H 8-269 None
7jy9 X-ray 2.8 A 8-269  H-Bb H-Mn L-Mj L-Mn 
7jy9 X-ray 2.8 B 8-269  H-Bb H-Mn L-Bb L-Mj L-Mn 
7jy9 X-ray 2.8 C 8-269  H-Bb H-Mn S-Bb S-Mj L-Bb L-Mj L-Mn 
7jy9 X-ray 2.8 D 8-269  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
7jy9 X-ray 2.8 E 8-269  S-Mj L-Bb L-Mj L-Mn 
7jy9 X-ray 2.8 F 8-269 None
7jy9 X-ray 2.8 G 8-269  L-Bb 
7jy9 X-ray 2.8 H 8-269 None


© NPIDB team 2003 - 2021

text