Pfam domain
Pfam family: DNA_pol_E_B (PF04042.18)
Uniprot AC: A0A6A5PTG9
RecName: BJ4_G0009800.mRNA.1.CDS.1
Begin-End: 214-446
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
IALVSGLNLNNTSPDRLLRLEILREFLMGRINNKIDDISLIGRLLICGNSVDFDIKSVNK
DELMISLTEFSKFLHNILPSISVDIMPGTNDPSDKSLPQQPFHKSLFDKSLESYFNGSNK
EILNLVTNPYEFSYNGVDVLAVSGKNINDICKYVIPSNDNGESENKVEEGESNDFKDDIE
HRLDLMECTMKWQNIAPTAPDTLWCYPYTDKDPFVLDKWPHVYIVANQPYFGT
Structures of the domain A0A6A5PTG9 214-446
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7kc0 X-ray 3.2 B 214-446 None


© NPIDB team 2003 - 2021

text