Pfam domain
Pfam family: zf-CXXC (PF02008.22)
Uniprot AC: A0JP82
RecName: Methylcytosine dioxygenase tet3
Begin-End: 59-98
Organism: Xenopus tropicalis
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
NKKRKRCGVCVPCLRKEPCGACYNCVNRSTSHQICKMRKC
Structures of the domain A0JP82 59-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4hp3 X-ray 2.05 C 59-98  H-Bb H-Mj L-Bb L-Mj L-Mn 
4hp1 X-ray 2.25 C 59-98  L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text