Pfam domain
Pfam family: RuvC_III (PF18541.3)
Uniprot AC: A0LWB3
RecName: CRISPR-associated endonuclease, Csn1 family
Begin-End: 685-832
Organism: Acidothermus cellulolyticus
Interaction Mode:   

Sequence:
GYAAVALRDRLLSYGEKNGVAQVAVFRGGVTAEARRWLDISIERLFSRVAIFAQSTSTKR
LDRRHHAVDAVVLTTLTPGVAKTLADARSRRVSAEFWRRPSDVNRHSTEEPQSPAYRQWK
ESCSGLGDLLISTAARDSIAVAAPLRLR
Structures of the domain A0LWB3 685-832
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wbr X-ray 2.91 A 682-810 None
6wc0 X-ray 3.61 A 682-810 None


© NPIDB team 2003 - 2021

text