Pfam domain
Pfam family: V-set (PF07686.16)
Uniprot AC: A0N7J2
RecName: Mc5 VHCH1 (Fragment)
Begin-End: 7-115
Organism: Mus sp.
Interaction Mode:   

Sequence:
SGGGLVQPGGSLKLSCAASGFTFSSYTMSWIRQTPEKRLEWVAYISDGGGSTYYPDTLKG
RFTVSRDNAKNTLYLQMSSLKSEDTAMYYCAINFYGMDSWGQGTSVTVS
Structures of the domain A0N7J2 7-115
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ok0 X-ray 1.89 H 7-111 None


© NPIDB team 2003 - 2019

text