Pfam domain
Pfam family: UDG (PF03167.21)
Uniprot AC: A0QP43
RecName: Type-4 uracil-DNA glycosylase
Begin-End: 38-202
Organism: Mycolicibacterium smegmatis
Interaction Mode:   

Sequence:
FGAGGRSARIMMIGEQPGDKEDLAGLPFVGPAGRLLDRALEAADIDRDALYVTNAVKHFK
FTRAAGGKRRIHKTPSRTEVVACRPWLIAEMTSVEPDVVVLLGATAAKALLGNDFRVTQH
RGEVLHVDDVPGDPALVATVHPSSLLRGPKEERESAFAGLVDDLR
Structures of the domain A0QP43 38-202
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ajo X-ray 2.27 A 38-202 None


© NPIDB team 2003 - 2021

text