Pfam domain
Pfam family: Ribosomal_L11_N (PF03946.13)
Uniprot AC: A0QS45
RecName: 50S ribosomal protein L11
Begin-End: 10-68
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
LIKLQIQAGQANPAPPVGPALGQHGVNIMEFCKAYNAATESQRGNVIPVEITVYEDRSF
Structures of the domain A0QS45 10-68
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o60 X-ray 3.2 J 11-68 None


© NPIDB team 2003 - 2019

text