Pfam domain
Pfam family: Ribosomal_L10 (PF00466.19)
Uniprot AC: A0QS62
RecName: 50S ribosomal protein L10
Begin-End: 1-98
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
MAKADKATAVADIAEQFKASTATVVTEYRGLTVANLAELRRALGDSATYTVAKNTLVKRA
ASEAGIEGLDELFAGPTAIAFVKGEAVDAAKAIKKFAK
Structures of the domain A0QS62 1-98
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5o60 X-ray 3.2 I 1-98 None


© NPIDB team 2003 - 2019

text