Pfam domain
Pfam family: RNA_pol_Rpb1_1 (PF04997.11)
Uniprot AC: A0QS66
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 4-417
Organism: Mycobacterium smegmatis
Interaction Mode:  H-Bb L-Bb 

Sequence:
VNFFDELRIGLATADDIRNWSYGEVKKPETINYRTLKPEKDGLFCEKIFGPTRDWECYCG
KYKRVRFKGIICERCGVEVTRAKVRRERMGHIELAAPVTHIWYFKGVPSRLGYLLDLAPK
DLEKIIYFAAYVITSVDDEMRHNELSTLEAEMAVEKKAVEDQRDADLEARAQKLEADLAE
LEAEGAKSDVRRKVRDSGEREMRQLRDRAQRELDRLDEIWNTFTKLAPKQLIVDEVLYRE
LQDRYGEYFTGAMGAESIKKLIENFDIDAEAESLREVIRSGKGQKKLRALKRLKVVAAFQ
QSGNSPMGMVLDAVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLIDLGAP
EIIVNNEKRMLQESVDALFDNGRRGRPVTGPGNRPLKSLSDLLKGKQGRFRQNL
Structures of the domain A0QS66 4-417
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 D 7-417  L-Bb 
5vi5 X-ray 3.2 D 7-417  H-Bb L-Bb 


© NPIDB team 2003 - 2019

text