Pfam domain
Pfam family: RNA_pol_Rpb1_2 (PF00623.19)
Uniprot AC: A0QS66
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 419-561
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
GKRVDYSGRSVIVVGPQLKLHQCGLPKLMALELFKPFVMKRLVDLNHAQNIKSAKRMVER
QRPQVWDVLEEVIAEHPVLLNRAPTLHRLGIQAFEPQLVEGKAIQLHPLVCEAFNADFDG
DQMAVHLPLSAEAQAEARILMLS
Structures of the domain A0QS66 419-561
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5tw1 X-ray 2.76 D 419-560 None
5vi5 X-ray 3.2 D 419-560 None


© NPIDB team 2003 - 2019

text