Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: A0QS66
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 840-1007
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
REGLTVLEYFINTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVREHDCETERGINVT
LAERGPDGTLIRDAHVETSAFARTLATDAVDANGNVIIERGHDLGDPAIDALLAAGITTV
KVRSVLTCTSATGVCAMCYGRSMATGKLVDIGEAVGIVAAQSIGEPGT
Structures of the domain A0QS66 840-1007
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ccv X-ray 3.05 D 842-1029 None
5vi8 X-ray 2.76 D 842-1028 None
5tw1 X-ray 2.76 D 842-1028 None


© NPIDB team 2003 - 2021

text