Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.24)
Uniprot AC: A0QS96
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
RRDKIAKVKTAALKGSPQRRGVCTRVYTTTPKKPNSALRKVARVKLTSQVEVTAYIPGEG
HNLQEHSMVLVRGGRVKDLPGVRYKIIRGSLDTQGVKNRKQARSRYGAKKEK
Structures of the domain A0QS96 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 L 12-123 None
5o5j X-ray 3.45 L 12-123 None


© NPIDB team 2003 - 2019

text