Pfam domain
Pfam family: Ribosomal_S7 (PF00177.20)
Uniprot AC: A0QS97
RecName: 30S ribosomal protein S7
Begin-End: 2-149
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
PRKGPAPKRPLVNDPVYGSQLVTQLVNKVLLEGKKSLAERIVYGALEQAREKTGTDPVVT
LKRALDNVKPALEVRSRRVGGATYQVPVEVRPDRSTTLALRWLVNFSRQRREKTMVERLA
NEILDASNGLGASVKRREDTHKMAEANR
Structures of the domain A0QS97 2-149
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xyu X-ray 3.45 G 3-149 None
5o5j X-ray 3.45 G 2-149 None


© NPIDB team 2003 - 2019

text