Pfam domain
Pfam family: Ribosomal_L3 (PF00297.21)
Uniprot AC: A0QSD1
RecName: 50S ribosomal protein L3
Begin-End: 80-191
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
HVAELRLDDEAAVAEYEVGQELTAEIFSDGAYVDVTGTSKGKGFAGTMKRHGFRGQGAAH
GAQAVHRRPGSIGGCATPGRVFKGTRMSGRMGNDRVTTQNLKVHKVDAENGV
Structures of the domain A0QSD1 80-191
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xym X-ray 3.08 D 97-187 None
5o60 X-ray 3.2 D 97-187 None


© NPIDB team 2003 - 2019

text