Pfam domain
Pfam family: Ribosomal_L4 (PF00573.21)
Uniprot AC: A0QSD2
RecName: 50S ribosomal protein L4
Begin-End: 18-206
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
VELPAELFDVEPNIALMHQVVTAQLAAKRQGTHSTKTRGEVSGGGKKPYRQKGTGRARQG
STRAPQFTGGGTVHGPKPRDYSQRTPKKMIAAALRGALSDRARNDRIHAVTELVEGQTPS
TKSAKTFLGTLTENKKVLVVIGRTDEVGAKSVRNLPGVHVISPDQLNTYDVLNADDVVFS
VEALNAYIS
Structures of the domain A0QSD2 18-206
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 E 18-202 None
5o60 X-ray 3.2 E 18-202 None
5xym X-ray 3.08 E 18-202 None
5zet X-ray 3.2 E 18-202 None


© NPIDB team 2003 - 2021

text