Pfam domain
Pfam family: Ribosomal_L2_C (PF03947.17)
Uniprot AC: A0QSD4
RecName: 50S ribosomal protein L2
Begin-End: 126-251
Organism: Mycobacterium smegmatis
Interaction Mode:   

Sequence:
KPGNNLPLRNIPAGTVIHAVELRPGGGAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRV
DVRCRATVGEVGNAEQSNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRH
PVSPWG
Structures of the domain A0QSD4 126-251
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6dzp X-ray 3.42 C 126-251 None
5o60 X-ray 3.2 C 126-251 None
5xym X-ray 3.08 C 126-251 None
5zet X-ray 3.2 C 126-251 None


© NPIDB team 2003 - 2021

text